PT000526

Amylin(34-71)-Synthetic Analogue

Pramlintide is a synthetic analogue of the naturally occurring neuroendocrine hormone Amylin, currently used for type I and type II diabetes patients. Amylin is also known as islet amyloid polypeptide (IAPP). Amylin (UniProt ID P10997) synthetic peptide analogue fragment (Lys34-Tyr71; UniProt position 34-71; aa length 37). The C-terminus is an amide.


Sequence:


K(CNTATC)ATQRLANFLVHSSNNFGPILLPPTNVGSNTY-NH2
H-Lys-(Cys-Asn-Thr-Ala-Thr-Cys)-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-His-Ser-Ser-Asn-Asn-Phe-Gly-Pro-Ile-Leu-leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2

Amylin(34-71)-Synthetic Analogue

Pramlintide is a synthetic analogue of the naturally occurring neuroendocrine hormone Amylin, currently used for type I and type II diabetes patients. Amylin is also known as islet amyloid polypeptide (IAPP). Amylin (UniProt ID P10997) synthetic peptide analogue fragment (Lys34-Tyr71; UniProt position 34-71; aa length 37). The C-terminus is an amide.


Sequence:

K(CNTATC)ATQRLANFLVHSSNNFGPILLPPTNVGSNTY-NH2
H-Lys-(Cys-Asn-Thr-Ala-Thr-Cys)-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-His-Ser-Ser-Asn-Asn-Phe-Gly-Pro-Ile-Leu-leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2

Skip to product information
1 of 0
Regular price Price
Inquire for price
Regular price Sale price $0.00 USD
In Stock Inquire
For research and development use only. Not for human or veterinary use.
Dry ice required. Additional fees may apply. For more details, visit our shipping page.
View full details
  • Other Names

    Formerly GP200100

  • Technical Data

    UniProt ID: P10997

    Formula: C177H278N52O54S2

    Molecular Weight: 4062.55

    Purity: >90% (HPLC)

  • Storage & Shipping

    Shipping requirement: Dry Ice

    Storage conditions: -20°C

1 of 3