PT000526: Amylin(34-71)-Synthetic Analogue

PT000526

Amylin(34-71)-Synthetic Analogue

Pramlintide is a synthetic analogue of the naturally occurring neuroendocrine hormone Amylin, currently used for type I and type II diabetes patients. Amylin is also known as islet amyloid polypeptide (IAPP). Amylin (UniProt ID P10997) synthetic peptide analogue fragment (Lys34-Tyr71; UniProt position 34-71; aa length 37). The C-terminus is an amide.

Sequence:


K(CNTATC)ATQRLANFLVHSSNNFGPILLPPTNVGSNTY-NH2
H-Lys-(Cys-Asn-Thr-Ala-Thr-Cys)-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-His-Ser-Ser-Asn-Asn-Phe-Gly-Pro-Ile-Leu-leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2

PT000526: Amylin(34-71)-Synthetic Analogue
$0.00 USD
$0.00 USD

Technical Data

UniProt ID: P10997

Formula: C177H278N52O54S2

Molecular Weight: 4062.55

Purity: >90% (HPLC)

Storage & Shipping

Shipping requirement: Dry Ice

Storage conditions: -20°C

Dry ice required. Additional fees may apply. For more details, visit our shipping page.

Other Names

Formerly GP200100

For research and development use only

Browse related products
GP200102: Amylin(34-71)-GlcNAc(65)-Synthetic Analogue

Amylin